PDB entry 1gku

View 1gku on RCSB PDB site
Description: reverse gyrase from archaeoglobus fulgidus
Class: topoisomerase
Keywords: topoisomerase, DNA supercoiling, archaea, helicase
Deposited on 2001-08-21, released 2002-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: reverse gyrase
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1GKU (13-End)
      • engineered mutation (718)
      • engineered mutation (1045)
    • Uniprot O29238 (32-1053)
    Domains in SCOPe 2.06: d1gkub1, d1gkub2, d1gkub3, d1gkub4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gkuB (B:)
    aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaslclfpedfllkefveffrkcvgeprai
    qkmwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetir
    kyaekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfif
    vddvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqll
    nfdigssritvrnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfr
    igivtatkkgdyekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtied
    idslspqmvkllaylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvrege
    vifpdlrtyiqgsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevd
    feklsreldesrdryrrrqefdlikpalfivesptkarqisrffgkpsvkvldgavvyei
    pmqkyvlmvtasighvvdlitnrgfhgvlvngrfvpvyasikrcrdcgyqftedrescpk
    cgsenvdnsrsriealrklahdaefvivgtdpdtegekiawdlknllsgcgavkraefhe
    vtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlv
    lgwiidrfqesrerrkiaivrdfdlvlehdeeefdltiklveereelrtplppyttetml
    sdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqriakeylgddfvgrewge
    sgahecirptrpltrddvqrliqegvlvveglrwehfalydlifrrfmasqcrpfkvvvk
    kysiefdgktaeeerivraegrayelyravwvknelptgtfrvkaevksvpkvlpftqse
    iiqmmkergigrpstyativdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsed
    rtrdlesrmdaiergeldylkaledmyaeiksid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkuB (B:)
    aaaaaaaaaaaaaaaaaaaslclfpedfllkefveffrkcvgepraiqkmwakrilrkes
    faataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgtenl
    igyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkaskn
    vdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssritvrn
    vedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrigivtatkkgdye
    kfvegeidhligtahrgldlperirfavfvgcpsfrvtiedidslspqmvkllaylyrnv
    deierllpaverhidevreilkkvmgkerpqakdvvvregevifpdlrtyiqgsgrtsrl
    faggltkgasflleddsellsafieraklydiefksidevdfeklsreldesrdryrrrq
    efdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvdl
    itnrgfhgvlvngrfvpvyasikdnsrsriealrklahdaefvivgtdpdtegekiawdl
    knllsgcgavkraefhevtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqklw
    erfnnrnlsagraqtlvlgwiidrfqesrerrkiaivrdfdlvlehdeeefdltiklvee
    reelrtplppyttetmlsdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqr
    iakeylgddfvgrewgesgahecirptrpltrddvqrliqegvlvveglrwehfalydli
    frrfmasqcrpfkvvvkkysiefdgktaeeerivraegrayelyravwvknelptgtfrv
    kaevksvpkvlpftqseiiqmmkergigrpstyativdrlfmrnyvvekygrmiptklgi
    dvfrflvrryakfvsedrtrdlesrmdaiergeldylkaledmyaeiksid