PDB entry 1ghj

View 1ghj on RCSB PDB site
Description: solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland II, nmr, minimized average structure
Class: acyltransferase
Keywords: glycolysis, transferase, acyltransferase, lipoyl
Deposited on 1996-01-16, released 1997-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ghja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghjA (A:)
    aidikaptfpesiadgtvatwhkkpgeavkrdelivdietdkvvmevlaeadgviaeivk
    negdtvlsgellgkltegg