PDB entry 1gd3

View 1gd3 on RCSB PDB site
Description: refined solution structure of human cystatin A
Class: protein binding
Keywords: cystatin A, Thiol protease inhibitor, PROTEIN BINDING
Deposited on 2000-09-08, released 2001-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cystatin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01040 (0-97)
    • engineered (64)
  Domains in SCOPe 2.06: d1gd3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gd3A (A:)
  mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
  dnkylhlkvfkslpgqnedlvltgyqvdknkddeltgf