PDB entry 1gd2

View 1gd2 on RCSB PDB site
Description: crystal structure of bzip transcription factor pap1 bound to DNA
Class: transcription/DNA
Keywords: basic leucine zipper, protein-DNA complex, transcription/DNA COMPLEX
Deposited on 2000-08-25, released 2000-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.23
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*gp*gp*tp*tp*ap*cp*gp*tp*ap*ap*cp*c)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*ap*gp*gp*tp*tp*ap*cp*gp*tp*ap*ap*cp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*ap*gp*gp*tp*tp*ap*cp*gp*tp*ap*ap*cp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*gp*gp*tp*tp*ap*cp*gp*tp*ap*ap*cp*c)-3')
  • Chain 'E':
    Compound: transcription factor pap1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gd2e_
  • Chain 'F':
    Compound: transcription factor pap1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gd2f_
  • Chain 'G':
    Compound: transcription factor pap1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gd2g_
  • Chain 'H':
    Compound: transcription factor pap1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gd2h_
  • Chain 'I':
    Compound: transcription factor pap1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gd2i_
  • Chain 'J':
    Compound: transcription factor pap1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gd2j_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gd2E (E:)
    rknsdqepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvr
    qleeelrilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd2E (E:)
    dqepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqlee
    elril
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gd2F (F:)
    rknsdqepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvr
    qleeelrilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd2F (F:)
    epsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqleeel
    rilk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gd2G (G:)
    rknsdqepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvr
    qleeelrilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd2G (G:)
    qepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqleee
    lril
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1gd2H (H:)
    rknsdqepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvr
    qleeelrilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd2H (H:)
    qepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqleee
    lril
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1gd2I (I:)
    rknsdqepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvr
    qleeelrilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd2I (I:)
    rkaqnretqvvtlkelhssttlendqlrvrqleeelrilk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1gd2J (J:)
    rknsdqepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvr
    qleeelrilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd2J (J:)
    tqvvtlkelhs