| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (2 families) ![]() |
| Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
| Protein PAP1 [57971] (1 species) |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [57972] (1 PDB entry) |
| Domain d1gd2f_: 1gd2 F: [45529] protein/DNA complex |
PDB Entry: 1gd2 (more details), 2 Å
SCOPe Domain Sequences for d1gd2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gd2f_ h.1.3.1 (F:) PAP1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
epsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqleeel
rilk
Timeline for d1gd2f_: