Lineage for d1gd2f_ (1gd2 F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039471Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 3039472Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 3039759Protein PAP1 [57971] (1 species)
  7. 3039760Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [57972] (1 PDB entry)
  8. 3039762Domain d1gd2f_: 1gd2 F: [45529]
    protein/DNA complex

Details for d1gd2f_

PDB Entry: 1gd2 (more details), 2 Å

PDB Description: crystal structure of bzip transcription factor pap1 bound to dna
PDB Compounds: (F:) transcription factor pap1

SCOPe Domain Sequences for d1gd2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd2f_ h.1.3.1 (F:) PAP1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
epsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqleeel
rilk

SCOPe Domain Coordinates for d1gd2f_:

Click to download the PDB-style file with coordinates for d1gd2f_.
(The format of our PDB-style files is described here.)

Timeline for d1gd2f_: