PDB entry 1gat

View 1gat on RCSB PDB site
Description: solution structure of the specific DNA complex of the zinc containing DNA binding domain of the erythroid transcription factor gata-1 by multidimensional nmr
Class: transcription/DNA
Keywords: DNA, double helix, DNA-transcription factor complex, transcription-DNA complex
Deposited on 1993-06-28, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythroid transcription factor gata-1
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1gata_
  • Chain 'B':
    Compound: DNA (5'-d(p*ap*gp*ap*tp*ap*ap*ap*c)3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: DNA (5'-d(p*gp*tp*tp*tp*ap*tp*cp*t)-3')
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gatA (A:)
    kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.