PDB entry 1g9o

View 1g9o on RCSB PDB site
Description: first pdz domain of the human na+/h+ exchanger regulatory factor
Deposited on 2000-11-26, released 2001-05-23
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1g9oa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g9oA (A:)
  rmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
  kethqqvvsriraalnavrllvvdpetdeql