Lineage for d1g9oa_ (1g9o A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58787Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 58788Superfamily b.36.1: PDZ domain-like [50156] (2 families) (S)
  5. 58789Family b.36.1.1: PDZ domain [50157] (9 proteins)
  6. 58801Protein Na+/H+ exchanger regulatory factor, NHERF [63754] (1 species)
  7. 58802Species Human (Homo sapiens) [TaxId:9606] [63755] (2 PDB entries)
  8. 58803Domain d1g9oa_: 1g9o A: [60400]

Details for d1g9oa_

PDB Entry: 1g9o (more details), 1.5 Å

PDB Description: first pdz domain of the human na+/h+ exchanger regulatory factor

SCOP Domain Sequences for d1g9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens)}
rmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
kethqqvvsriraalnavrllvvdpetdeql

SCOP Domain Coordinates for d1g9oa_:

Click to download the PDB-style file with coordinates for d1g9oa_.
(The format of our PDB-style files is described here.)

Timeline for d1g9oa_: