PDB entry 1g90

View 1g90 on RCSB PDB site
Description: NMR Solution Structure of Outer Membrane Protein A Transmembrane Domain: 10 conformers
Class: membrane protein
Keywords: beta barrel, integral membrane protein, nmr
Deposited on 2000-11-21, released 2001-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: outer membrane protein a
  Species: Escherichia coli [TaxId:562]
  Gene: OMPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A910 (0-175)
    • engineered (14)
    • engineered (56)
    • engineered (101)
    • engineered (142)
  Domains in SCOPe 2.08: d1g90a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g90A (A:)
  apkdntwytgaklgfsqyhdtgfinnngpthenqlgagafggyqvnpyvgfemgydflgr
  mpykgsvengaykaqgvqltaklgypitddldiytrlggmvfradtksnvygknhdtgvs
  pvfaggveyaitpeiatrleyqftnnigdahtigtrpdngmlslgvsyrfgqgeaa