Lineage for d1g90a_ (1g90 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3021957Family f.4.1.1: Outer membrane protein [56926] (3 proteins)
    automatically mapped to Pfam PF13505
  6. 3021958Protein Outer membrane protein A (OMPA) transmembrane domain [56927] (1 species)
  7. 3021959Species Escherichia coli [TaxId:562] [56928] (5 PDB entries)
  8. 3021963Domain d1g90a_: 1g90 A: [60388]

Details for d1g90a_

PDB Entry: 1g90 (more details)

PDB Description: nmr solution structure of outer membrane protein a transmembrane domain: 10 conformers
PDB Compounds: (A:) outer membrane protein a

SCOPe Domain Sequences for d1g90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g90a_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli [TaxId: 562]}
apkdntwytgaklgfsqyhdtgfinnngpthenqlgagafggyqvnpyvgfemgydflgr
mpykgsvengaykaqgvqltaklgypitddldiytrlggmvfradtksnvygknhdtgvs
pvfaggveyaitpeiatrleyqftnnigdahtigtrpdngmlslgvsyrfgqgeaa

SCOPe Domain Coordinates for d1g90a_:

Click to download the PDB-style file with coordinates for d1g90a_.
(The format of our PDB-style files is described here.)

Timeline for d1g90a_: