PDB entry 1g84

View 1g84 on RCSB PDB site
Description: the solution structure of the c epsilon2 domain from ige
Class: immune system
Keywords: allergy, IgE, immunoglobulin domain, Ce2, antibody, Fc., IMMUNE SYSTEM
Deposited on 2000-11-16, released 2001-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: immunoglobulin e
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01854 (0-104)
    • engineered (15)
    • engineered (103)
  Domains in SCOPe 2.08: d1g84a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g84A (A:)
  srdftpptvkilqsssdggghfpptiqllclvsgytpgtinitwledgqvmdvdlstast
  tqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkksa