PDB entry 1g7u

View 1g7u on RCSB PDB site
Description: crystal structures of kdo8p synthase in its binary complex with substrate phosphoenol pyruvate
Class: lyase
Keywords: beta-alpha-barrels, lyase, lipopolysaccharide
Deposited on 2000-11-14, released 2001-05-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A715 (0-283)
      • conflict (210)
    Domains in SCOPe 2.02: d1g7ua_
  • Heterogens: PEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7uA (A:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqcrdpfvaasggrraqvaelaragmavglaglfiea
    hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk