PDB entry 1g5w

View 1g5w on RCSB PDB site
Description: solution structure of human heart-type fatty acid binding protein
Class: lipid binding protein
Keywords: NMR spectroscopy, protein-ligand interactions, selected-fit binding, LIPID BINDING PROTEIN
Deposited on 2000-11-02, released 2001-03-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1g5wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g5wA (A:)
vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
tavctrtyekea