SCOPe 2.05: Domain d1g5wa_: 1g5w A:

Lineage for d1g5wa_ (1g5w A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50849] (6 PDB entries)

8. Domain d1g5wa_: 1g5w A: [60293]
   heart-type

Details for d1g5wa_

PDB Entry: 1g5w

PDB Description: solution structure of human heart-type fatty acid binding protein

PDB Compounds: (A:) fatty acid-binding protein

SCOPe Domain Sequences for d1g5wa_:

Sequence; same for both SEQRES and ATOM records:

>d1g5wa_ b.60.1.2 (A:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
tavctrtyekea

Timeline for d1g5wa_:

• d1g5wa_ first appeared in SCOP 1.57
  
• d1g5wa_ appears in SCOPe 2.04
  
• d1g5wa_ appears in SCOPe 2.06
  
• d1g5wa_ appears in the current release, SCOPe 2.08