PDB entry 1g5i

View 1g5i on RCSB PDB site
Description: crystal structure of the accessory subunit of murine mitochondrial polymerase gamma
Class: DNA binding protein
Keywords: intermolecular four helix bundle, DNA BINDING PROTEIN
Deposited on 2000-11-01, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial DNA polymerase accessory subunit
    Species: Mus musculus [TaxId:10090]
    Gene: DNA POLYMERASE GAMMA SUBUNIT B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZM2 (Start-442)
      • expression tag (443-452)
    Domains in SCOPe 2.07: d1g5ia1, d1g5ia2, d1g5ia3
  • Chain 'B':
    Compound: mitochondrial DNA polymerase accessory subunit
    Species: Mus musculus [TaxId:10090]
    Gene: DNA POLYMERASE GAMMA SUBUNIT B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZM2 (Start-442)
      • expression tag (443)
    Domains in SCOPe 2.07: d1g5ib1, d1g5ib2, d1g5ib3
  • Chain 'C':
    Compound: mitochondrial DNA polymerase accessory subunit
    Species: Mus musculus [TaxId:10090]
    Gene: DNA POLYMERASE GAMMA SUBUNIT B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZM2 (Start-442)
      • expression tag (443-452)
    Domains in SCOPe 2.07: d1g5ic1, d1g5ic2, d1g5ic3
  • Chain 'D':
    Compound: mitochondrial DNA polymerase accessory subunit
    Species: Mus musculus [TaxId:10090]
    Gene: DNA POLYMERASE GAMMA SUBUNIT B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZM2 (Start-442)
      • expression tag (443-451)
    Domains in SCOPe 2.07: d1g5id1, d1g5id2, d1g5id3
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g5iA (A:)
    wlsgyagpadgtqqpdapehavarealvdlcrrrhflsgtpqqlstaallsgcharfgpl
    gvelrknlasqwwssmvvfreqvfavdslhqepgssqprdsafrlvspesireilqdrep
    skeqlvaflenllktsgklratllhgalehyvncldlvnrklpfglaqigvcfhpvsnsn
    qtpssvtrvgekteaslvwftptrtssqwldfwlrhrllwwrkfamspsnfssadcqdel
    grkgsklyysfpwgkepietlwnlgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdv
    dlgtlaylydsfqlaensfarkkslqrkvlklhpclapikvaldvgkgptvelrqvcqgl
    lnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlengliqlrsrdttm
    kemmhisklrdflvkylasasnvaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5iA (A:)
    ealvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqvf
    avdslhqepgssqprdsafrlvspesireilqdskeqlvaflenllktsgklratllhga
    lehyvncldlvnrklpfglaqigvcfhpvstrvgekteaslvwftptrtssqwldfwlrh
    rllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgn
    vstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlrkvlklhpclapikvaldvgkg
    ptvelrqvcqgllnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlen
    gliqlrsrdttmkemmhisklrdflvkylasasnvaaaldhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g5iB (B:)
    wlsgyagpadgtqqpdapehavarealvdlcrrrhflsgtpqqlstaallsgcharfgpl
    gvelrknlasqwwssmvvfreqvfavdslhqepgssqprdsafrlvspesireilqdrep
    skeqlvaflenllktsgklratllhgalehyvncldlvnrklpfglaqigvcfhpvsnsn
    qtpssvtrvgekteaslvwftptrtssqwldfwlrhrllwwrkfamspsnfssadcqdel
    grkgsklyysfpwgkepietlwnlgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdv
    dlgtlaylydsfqlaensfarkkslqrkvlklhpclapikvaldvgkgptvelrqvcqgl
    lnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlengliqlrsrdttm
    kemmhisklrdflvkylasasnvaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5iB (B:)
    realvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqv
    favdslhqepgrdsafrlvspesireilqdrepskeqlvaflenllktsgklratllhga
    lehyvncldlvnrklpfglaqigvcfhpvsrvgekteaslvwftptrtssqwldfwlrhr
    llwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgnv
    stiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlaerkvlklhpclapikvaldvgk
    gptvelrqvcqgllnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettle
    ngliqlrsrdttmkemmhisklrdflvkylasasnva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g5iC (C:)
    wlsgyagpadgtqqpdapehavarealvdlcrrrhflsgtpqqlstaallsgcharfgpl
    gvelrknlasqwwssmvvfreqvfavdslhqepgssqprdsafrlvspesireilqdrep
    skeqlvaflenllktsgklratllhgalehyvncldlvnrklpfglaqigvcfhpvsnsn
    qtpssvtrvgekteaslvwftptrtssqwldfwlrhrllwwrkfamspsnfssadcqdel
    grkgsklyysfpwgkepietlwnlgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdv
    dlgtlaylydsfqlaensfarkkslqrkvlklhpclapikvaldvgkgptvelrqvcqgl
    lnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlengliqlrsrdttm
    kemmhisklrdflvkylasasnvaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5iC (C:)
    ealvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqvf
    avdslhqepgssqprdsafrlvspesireilqdskeqlvaflenllktsgklratllhga
    lehyvncldlvnrklpfglaqigvcfhpvstrvgekteaslvwftptrtssqwldfwlrh
    rllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgn
    vstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlrkvlklhpclapikvaldvgkg
    ptvelrqvcqgllnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlen
    gliqlrsrdttmkemmhisklrdflvkylasasnvaaaldhhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g5iD (D:)
    wlsgyagpadgtqqpdapehavarealvdlcrrrhflsgtpqqlstaallsgcharfgpl
    gvelrknlasqwwssmvvfreqvfavdslhqepgssqprdsafrlvspesireilqdrep
    skeqlvaflenllktsgklratllhgalehyvncldlvnrklpfglaqigvcfhpvsnsn
    qtpssvtrvgekteaslvwftptrtssqwldfwlrhrllwwrkfamspsnfssadcqdel
    grkgsklyysfpwgkepietlwnlgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdv
    dlgtlaylydsfqlaensfarkkslqrkvlklhpclapikvaldvgkgptvelrqvcqgl
    lnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlengliqlrsrdttm
    kemmhisklrdflvkylasasnvaaaldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5iD (D:)
    realvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqv
    favdslhqepgrdsafrlvspesireilqdrepskeqlvaflenllktsgklratllhga
    lehyvncldlvnrklpfglaqigvcfhpvsrvgekteaslvwftptrtssqwldfwlrhr
    llwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgnv
    stiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlaensfarkkslqrkvlklhpcla
    pikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhssleqlhskydemsvlf
    svlvtettlengliqlrsrdttmkemmhisklrdflvkylasasnvaaaldhhhh