![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain [64349] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [64350] (2 PDB entries) |
![]() | Domain d1g5ia2: 1g5i A:41-330 [60279] Other proteins in same PDB: d1g5ia1, d1g5ia3, d1g5ib1, d1g5ib3, d1g5ic1, d1g5ic3, d1g5id1, d1g5id3 complexed with gol, na has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1g5i (more details), 2.3 Å
SCOPe Domain Sequences for d1g5ia2:
Sequence, based on SEQRES records: (download)
>d1g5ia2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} ealvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqvf avdslhqepgssqprdsafrlvspesireilqdrepskeqlvaflenllktsgklratll hgalehyvncldlvnrklpfglaqigvcfhpvsnsnqtpssvtrvgekteaslvwftptr tssqwldfwlrhrllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnl gdqellhtypgnvstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfql
>d1g5ia2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} ealvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqvf avdslhqepgssqprdsafrlvspesireilqdskeqlvaflenllktsgklratllhga lehyvncldlvnrklpfglaqigvcfhpvstrvgekteaslvwftptrtssqwldfwlrh rllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgn vstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfql
Timeline for d1g5ia2: