PDB entry 1g4u

View 1g4u on RCSB PDB site
Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1
Class: signaling protein
Keywords: virulence factor, GAP, tyrosine phosphatase, 4-helix bundle, GTPase, SIGNALING PROTEIN
Deposited on 2000-10-28, released 2001-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (0-End)
      • engineered (77)
    Domains in SCOPe 2.07: d1g4ur_
  • Chain 'S':
    Compound: protein tyrosine phosphatase sptp
    Species: Salmonella typhimurium [TaxId:602]
    Gene: SPTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g4us1, d1g4us2
  • Heterogens: MG, GDP, AF3, HOH

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1g4uR (R:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4uR (R:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1g4uS (S:)
    ndvgaeskqplldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnk
    ipeakqlndyvttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakel
    knvtaelekieagapmpqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdg
    kpvalagsypkntpdaleahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevh
    tnsqkvssasqgeaidqynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvkn
    snqngapgrsssdkhlpmihclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrm
    ledasqfvqlkamqaqllmttas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4uS (S:)
    skqplldialkglkrtlpqleqmdgnslrenfqemasgngplrslmtnlqnlnkipeakq
    lndyvttltniqvgvarfsqwgtcggeverwvdkastheltqavkkihviakelknvtae
    lekieagapmpqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvala
    gsypkntpdaleahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkv
    ssasqgeaidqynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknkhlpmi
    hclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvqlkamqaqllm