![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
![]() | Protein SptP tyrosine phosphatase, catalytic domain [52813] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [52814] (2 PDB entries) |
![]() | Domain d1g4us2: 1g4u S:297-539 [32691] Other proteins in same PDB: d1g4ur_, d1g4us1 complexed with af3, gdp, mg |
PDB Entry: 1g4u (more details), 2.3 Å
SCOPe Domain Sequences for d1g4us2:
Sequence, based on SEQRES records: (download)
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} pqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvalagsypkntpda leahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkvssasqgeaid qynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknsnqngapgrsssdkhl pmihclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvqlkamqaq llm
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} pqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvalagsypkntpda leahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkvssasqgeaid qynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknkhlpmihclggvgrtg tmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvqlkamqaqllm
Timeline for d1g4us2: