PDB entry 1g1i

View 1g1i on RCSB PDB site
Description: crystal structure of the oligomerization domain from rotavirus nsp4
Deposited on 2000-10-11, released 2001-01-10
The last revision prior to the SCOP 1.59 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.235
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1g1ia_
  • Chain 'B':
    Domains in SCOP 1.59: d1g1ib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g1iA (A:)
iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g1iB (B:)
iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq