PDB entry 1g1g

View 1g1g on RCSB PDB site
Description: crystal structure of protein tyrosine phosphatase 1b complexed with a mono-phosphorylated peptide (etdy(ptr)rkggkgll) from the insulin receptor kinase
Class: hydrolase, signaling protein
Keywords: hydrolase (phosphorylation), tyrosine phosphatase, peptide complex, hydrolase, signaling protein
Deposited on 2000-10-11, released 2001-01-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase 1b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (0-297)
      • engineered (214)
    Domains in SCOPe 2.06: d1g1ga_
  • Chain 'B':
    Compound: mono-phosphorylated peptide from the insulin receptor kinase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1G1G
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1gA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

  • Chain 'B':
    No sequence available.