PDB entry 1g02

View 1g02 on RCSB PDB site
Description: Ribonuclease T1 V16S mutant
Deposited on 2000-10-05, released 2000-10-25
The last revision prior to the SCOP 1.61 freeze date was dated 2000-10-25, with a file datestamp of 2000-10-25.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1g02a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g02A (A:)
acdytcgsncysssdsstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect