PDB entry 1fys

View 1fys on RCSB PDB site
Description: Ribonuclease T1 V16C mutant
Class: hydrolase
Keywords: ribonuclease, HYDROLASE
Deposited on 2000-10-03, released 2000-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: guanyl-specific ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • engineered (15)
    • conflict (24)
  Domains in SCOPe 2.07: d1fysa_
• Heterogens: CA, 2GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fysA (A:)
  acdytcgsncysssdcstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect