PDB entry 1fy1

View 1fy1 on RCSB PDB site
Description: [r23s,f25e]hbp, a mutant of human heparin binding protein (cap37)
Class: antimicrobial protein
Keywords: Serine protease homolog, Endotoxin (lipid A) binding site, ANTIMICROBIAL PROTEIN
Deposited on 2000-09-28, released 2001-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: heparin-binding protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20160 (0-224)
    • engineered (22)
    • engineered (24)
  Domains in SCOPe 2.07: d1fy1a_
• Heterogens: NAG, EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fy1A (A:)
  ivggrkarprqfpflasiqnqgshecggaliharfvmtaascfqsqnpgvstvvlgaydl
  rrrerqsrqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveag
  trcqvagwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdggtplv
  ceglahgvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa