PDB entry 1fwp

View 1fwp on RCSB PDB site
Description: chey-binding domain of chea (residues 159-227), nmr, minimized average structure
Class: chemotaxis
Keywords: kinase, signal transduction, chemotaxis
Deposited on 1996-02-06, released 1996-07-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chea
    Species: Escherichia coli [TaxId:562]
    Gene: CHEA (RESIDUES 124-257)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1fwpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fwpA (A:)
    rqlaleakgetpsavtrlsvvaksepqdeqsrsqsprriilsrlkagevdlleeelghlt
    tltdvvkgadslsailpgdiaedditavlcfvieadqitfetvevspkistppvlklaae
    qaptgrverekttriklgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwpA (A:)
    prriilsrlkagevdlleeelghlttltdvvkgadslsailpgdiaedditavlcfviea
    dqitfetve