PDB entry 1frd

View 1frd on RCSB PDB site
Description: molecular structure of the oxidized, recombinant, heterocyst (2fe-2s) ferredoxin from anabaena 7120 determined to 1.7 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1993-04-14, released 1994-05-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterocyst [2fe-2s] ferredoxin
    Species: Nostoc sp. [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1frda_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frdA (A:)
    asyqvrlinkkqdidttieideettildgaeengielpfschsgscsscvgkvvegevdq
    sdqiflddeqmgkgfallcvtyprsnctikthqepyla