PDB entry 1fr0

View 1fr0 on RCSB PDB site
Description: solution structure of the histidine-containing phosphotransfer domain of anaerobic sensor kinase arcb from escherichia coli.
Deposited on 2000-09-07, released 2001-03-14
The last revision prior to the SCOP 1.63 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1fr0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fr0A (A:)
    tteensksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiv
    eeghkikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawva
    katkk