PDB entry 1fr0

View 1fr0 on RCSB PDB site
Description: solution structure of the histidine-containing phosphotransfer domain of anaerobic sensor kinase arcb from escherichia coli.
Class: transferase
Keywords: four-helix bundle motif,anaerobic sensor kinase,, TRANSFERASE
Deposited on 2000-09-07, released 2001-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arcb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fr0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fr0A (A:)
    tteensksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiv
    eeghkikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawva
    katkk