PDB entry 1fqt

View 1fqt on RCSB PDB site
Description: crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase
Deposited on 2000-09-06, released 2001-01-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-01-03, with a file datestamp of 2001-01-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fqta_
  • Chain 'B':
    Domains in SCOP 1.59: d1fqtb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fqtA (A:)
mkftrvcdrrdvpegealkvesggtsvaifnvdgelfatqdrcthgdwslsdggylegdv
vecslhmgkfcvrtgkvkspppcealkifpiriedndvlvdfeagylap

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fqtB (B:)
mkftrvcdrrdvpegealkvesggtsvaifnvdgelfatqdrcthgdwslsdggylegdv
vecslhmgkfcvrtgkvkspppcealkifpiriedndvlvdfeagylap