PDB entry 1fpr

View 1fpr on RCSB PDB site
Description: crystal structure of the complex formed between the catalytic domain of shp-1 and an in vitro peptide substrate py469 derived from shps-1.
Class: signaling protein
Keywords: protein tyrosine phosphatase, substrate specificity, residue shift, SIGNALING PROTEIN
Deposited on 2000-08-31, released 2001-03-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase 1c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29350 (0-283)
      • engineered (210)
    Domains in SCOPe 2.02: d1fpra_
  • Chain 'B':
    Compound: peptide py469
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1FPR (0-9)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fprA (A:)
gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv
pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv
psepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldcdi
diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevl

  • Chain 'B':
    No sequence available.