PDB entry 1foy

View 1foy on RCSB PDB site
Description: the RNA binding domain of ribosomal protein l11: three-dimensional structure of the RNA-bound form of the protein, nmr, minimized average structure
Class: ribosome
Keywords: ribosome, protein/RNA, thiostrepton
Deposited on 1997-05-26, released 1997-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein l11
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1foya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1foyA (A:)
    mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
    rmiegtarsmgivved