PDB entry 1fo5

View 1fo5 on RCSB PDB site
Description: solution structure of reduced mj0307
Class: oxidoreductase
Keywords: disulfide oxidoreductase, thioredoxin fold, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, PSI, Protein Structure Initiative
Deposited on 2000-08-24, released 2001-04-11
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Methanococcus jannaschii
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57755 (0-84)
  Domains in SCOP 1.73: d1fo5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fo5A (A:)
  mskvkielftspmcphcpaakrvveevanempdaveveyinvmenpqkameygimavpti
  vingdvefigaptkealveaikkrl