SCOP 1.73: Domain d1fo5a_: 1fo5 A:

Lineage for d1fo5a_ (1fo5 A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein MJ0307, thioredoxin/glutaredoxin-like protein [64054] (1 species)
   single-domain PDI

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [64055] (1 PDB entry)

8. Domain d1fo5a_: 1fo5 A: [59922]

Details for d1fo5a_

PDB Entry: 1fo5

PDB Description: solution structure of reduced mj0307

PDB Compounds: (A:) thioredoxin

SCOP Domain Sequences for d1fo5a_:

Sequence; same for both SEQRES and ATOM records:

>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]}
mskvkielftspmcphcpaakrvveevanempdaveveyinvmenpqkameygimavpti
vingdvefigaptkealveaikkrl

Timeline for d1fo5a_:

• d1fo5a_ first appeared in SCOP 1.57
  
• d1fo5a_ appears in SCOP 1.71
  
• d1fo5a_ appears in SCOP 1.75
  
• d1fo5a_ appears in the current release, SCOPe 2.08