PDB entry 1fli

View 1fli on RCSB PDB site
Description: dna-binding domain of fli-1
Deposited on 1994-09-15, released 1995-09-15
The last revision prior to the SCOP 1.63 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-21.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1flia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fliA (A:)
    pgsgqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydkl
    sralryyydknimtkvhgkryaykfdfhgiaqalqphp