PDB entry 1fkg

View 1fkg on RCSB PDB site
Description: design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Class: cis-trans isomerase
Keywords: cis-trans isomerase
Deposited on 1993-08-05, released 1994-01-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1fkga_
  • Heterogens: SB3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fkgA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle