PDB entry 1fhb

View 1fhb on RCSB PDB site
Description: three-dimensional solution structure of the cyanide adduct of a met80ala variant of saccharomyces cerevisiae iso-1-cytochrome c. identification of ligand-residue interactions in the distal heme cavity
Deposited on 1995-06-16, released 1995-09-15
The last revision prior to the SCOP 1.63 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1fhb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhb_ (-)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrqsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkaafgglkkekdrndlitylkkase