PDB entry 1ffd

View 1ffd on RCSB PDB site
Description: contribution of cutinase serine 42 side chain to the stabilization of the oxyanion transition state
Deposited on 1995-10-07, released 1996-03-08
The last revision prior to the SCOP 1.61 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.144
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1ffd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffd_ (-)
    rttrddlingnsascrdvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdwalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs