PDB entry 1f7l

View 1f7l on RCSB PDB site
Description: holo-(acyl carrier protein) synthase in complex with coenzyme a at 1.5a
Deposited on 2000-06-27, released 2001-06-27
The last revision prior to the SCOP 1.63 freeze date was dated 2001-06-27, with a file datestamp of 2001-06-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1f7la_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f7lA (A:)
  giygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeaf
  skafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvier