PDB entry 1f7a
View 1f7a on RCSB PDB site
Description: how does a symmetric dimer recognize an asymmetric substrate? a substrate complex of hiv-1 protease.
Class: hydrolase
Keywords: capsid, substrate recognition, hydrolase
Deposited on
2000-06-26, released
2001-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (24)
Domains in SCOPe 2.06: d1f7aa_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (24)
Domains in SCOPe 2.06: d1f7ab_ - Chain 'P':
Compound: ca-p2 substrate
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1f7aA (A:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1f7aB (B:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'P':
No sequence available.