PDB entry 1f65

View 1f65 on RCSB PDB site
Description: crystal structure of oxy sperm whale myoglobin mutant y(b10)q(e7) r(e10)
Deposited on 2000-06-20, released 2000-07-19
The last revision prior to the SCOP 1.63 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1f65a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f65A (A:)
    mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
    dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg