PDB entry 1f41

View 1f41 on RCSB PDB site
Description: crystal structure of human transthyretin at 1.5a resolution
Deposited on 2000-06-07, released 2000-09-20
The last revision prior to the SCOP 1.61 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.188
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1f41a_
  • Chain 'B':
    Domains in SCOP 1.61: d1f41b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f41A (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f41B (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn