PDB entry 1f40

View 1f40 on RCSB PDB site
Description: solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand
Class: isomerase
Keywords: isomerase
Deposited on 2000-06-07, released 2000-11-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fk506 binding protein (fkbp12)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
  Domains in SCOPe 2.02: d1f40a_
• Heterogens: GPI

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f40A (A:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle