PDB entry 1f3o

View 1f3o on RCSB PDB site
Description: crystal structure of mj0796 atp-binding cassette
Deposited on 2000-06-05, released 2001-07-25
The last revision prior to the SCOP 1.59 freeze date was dated 2001-07-25, with a file datestamp of 2001-07-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1f3oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f3oA (A:)
miklknvtktykmgeeiiyalknvnlnikegefvsimgpsgsgkstmlniigcldkpteg
evyidniktndldddeltkirrdkigfvfqqfnliplltalenvelplifkyrgamsgee
rrkraleclkmaeleerfanhkpnqlsggqqqrvaiaralannppiiladeptgaldskt
gekimqllkklneedgktvvvvthdinvarfgeriiylkdgevereeklrgf