PDB entry 1f3c
View 1f3c on RCSB PDB site
Description: refined solution structure of 8kda dynein light chain (dlc8)
Class: contractile protein
Keywords: dynein, light chain, DLC8, microtubules, CONTRACTILE PROTEIN
Deposited on
2000-06-02, released
2001-02-28
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: dynein
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1f3ca_ - Chain 'B':
Compound: dynein
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1f3cb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1f3cA (A:)
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1f3cB (B:)
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg