PDB entry 1f3c

View 1f3c on RCSB PDB site
Description: refined solution structure of 8kda dynein light chain (dlc8)
Class: contractile protein
Keywords: dynein, light chain, DLC8, microtubules, CONTRACTILE PROTEIN
Deposited on 2000-06-02, released 2001-02-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dynein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3ca_
  • Chain 'B':
    Compound: dynein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3cb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3cA (A:)
    mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
    nfgsyvthetkhfiyfylgqvaillfksg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3cB (B:)
    mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
    nfgsyvthetkhfiyfylgqvaillfksg