PDB entry 1f2g

View 1f2g on RCSB PDB site
Description: the nmr solution structure of the 3fe ferredoxin II from desulfovibrio gigas, 15 structures
Class: electron transport
Keywords: electron transport, fdii desulfovibrio gigas, ferredoxin II
Deposited on 1998-10-08, released 1999-09-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin II
  Species: Desulfovibrio gigas
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00209 (0-57)
  Domains in SCOP 1.73: d1f2ga_
• Heterogens: F3S

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f2gA (A:)
  pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs