Lineage for d1f2ga_ (1f2g A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723374Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 723447Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
    contains only one 4Fe-4S cluster
  6. 723466Protein Ferredoxin I [54880] (2 species)
  7. 723467Species Desulfovibrio gigas [TaxId:879] [54865] (2 PDB entries)
  8. 723469Domain d1f2ga_: 1f2g A: [38942]
    complexed with fs3

Details for d1f2ga_

PDB Entry: 1f2g (more details)

PDB Description: the nmr solution structure of the 3fe ferredoxin ii from desulfovibrio gigas, 15 structures
PDB Compounds: (A:) ferredoxin II

SCOP Domain Sequences for d1f2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2ga_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}
pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs

SCOP Domain Coordinates for d1f2ga_:

Click to download the PDB-style file with coordinates for d1f2ga_.
(The format of our PDB-style files is described here.)

Timeline for d1f2ga_: