PDB entry 1f03

View 1f03 on RCSB PDB site
Description: solution structure of oxidized bovine microsomal cytochrome b5 mutant (e44a, e48a, e56a, d60a) and its interaction with cytochrome c
Class: electron transport
Keywords: cytochrome b5, protein recognition, solution structure, paramagnetic nmr, electron transport
Deposited on 2000-05-14, released 2000-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (41)
      • engineered (45)
      • engineered (53)
      • engineered (57)
    Domains in SCOPe 2.06: d1f03a_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f03A (A:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeavlraqaggdatanfeavg
    hstdarelsktfiigelhpddr