PDB entry 1ezc

View 1ezc on RCSB PDB site
Description: amino terminal domain of enzyme I from escherichia coli, nmr, 17 structures
Class: phosphotransferase
Keywords: phosphotransferase, kinase, sugar transport
Deposited on 1997-01-01, released 1998-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enzyme I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ezca1, d1ezca2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ezcA (A:)
misgilaspgiafgkalllkedeividrkkisadqvdqeverflsgrakasaqletiktk
agetfgeekeaifeghimlledeeleqeiialikdkhmtadaaaheviegqasaleeldd
eylkeraadvrdigkrllrnilglkiidlsaiqdevilvaadltpsetaqlnlkkvlgfi
tdaggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmr
avqeqvasekaelaklkdr