PDB entry 1ez2

View 1ez2 on RCSB PDB site
Description: three-dimensional structure of the zinc-containing phosphotriesterase with bound substrate analog diisopropylmethyl phosphonate.
Class: hydrolase
Keywords: hydrolase zinc organophosphate, hydrolase
Deposited on 2000-05-09, released 2000-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (0-End)
      • modified residue (134)
    Domains in SCOPe 2.07: d1ez2a_
  • Chain 'B':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (0-End)
      • modified residue (134)
    Domains in SCOPe 2.07: d1ez2b_
  • Heterogens: ZN, DII, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ez2A (A:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
    vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez2A (A:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
    vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflsptlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ez2B (B:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
    vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez2B (B:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
    vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflsptlr