Lineage for d1ez2b_ (1ez2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833482Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2833483Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)
  7. 2833520Species Pseudomonas diminuta [TaxId:293] [51566] (41 PDB entries)
    Uniprot P0A434 30-365
  8. 2833578Domain d1ez2b_: 1ez2 B: [29061]
    complexed with dii, zn

Details for d1ez2b_

PDB Entry: 1ez2 (more details), 1.9 Å

PDB Description: three-dimensional structure of the zinc-containing phosphotriesterase with bound substrate analog diisopropylmethyl phosphonate.
PDB Compounds: (B:) phosphotriesterase

SCOPe Domain Sequences for d1ez2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez2b_ c.1.9.3 (B:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflsptlr

SCOPe Domain Coordinates for d1ez2b_:

Click to download the PDB-style file with coordinates for d1ez2b_.
(The format of our PDB-style files is described here.)

Timeline for d1ez2b_: