SCOP 1.59: Structural Classification of Proteins

PDB entry 1ext

View 1ext on RCSB PDB site
Description: extracellular domain of the 55kda tumor necrosis factor receptor. crystallized at ph3.7 in p 21 21 21.
Deposited on 1996-07-03, released 1997-01-11
The last revision prior to the SCOP 1.59 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.203
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Domains in SCOP 1.59: d1exta1, d1exta2, d1exta3
Chain 'B':
Domains in SCOP 1.59: d1extb1, d1extb2, d1extb3

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>1extA (A:)
svcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhcls
cskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcfncslclngtvhlscqek
qntvctchagfflrenecvscsnckkslectklclpqien

Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)

>1extB (B:)
mdsvcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhc
lscskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcfncslclngtvhlscq
ekqntvctchagfflrenecvscsnckkslectklclp